PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000253526
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 147aa    MW: 16597.9 Da    PI: 9.2641
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000253526genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP72.21.6e-2285144261
            TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaike 61 
                     g+kd hsk++T +g+RdR vRls+++a++++dLq++LG+ ++sk ++WL+ +   +++ 
  MDP0000253526  85 FGGKDMHSKVCTIRGLRDRHVRLSVPTAIQLYDLQERLGLNQPSKVVDWLFDDDHNQVQL 144
                    689************************************************987777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136921.82987145IPR017887Transcription factor TCP subgroup
PfamPF036341.3E-2087145IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MGVERYYQLA KNPATIGCRK LENGLLEGGE EQQKYSGGWL WSSMTSRECV AKEANKISSN  60
PNLSRSSTPW PRLKDPRIVC ASRAFGGKDM HSKVCTIRGL RDRHVRLSVP TAIQLYDLQE  120
RLGLNQPSKV VDWLFDDDHN QVQLLPG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.163241e-111fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5010672e-42KM501067.1 Malus domestica TCP domain-containing protein 13 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008348175.17e-92PREDICTED: transcription factor TCP13-like
SwissprotQ9S7W52e-34TCP13_ARATH; Transcription factor TCP13
TrEMBLM5WST03e-40M5WST0_PRUPE; Uncharacterized protein
STRINGPGSC0003DMT4000034531e-37(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.15e-36plastid transcription factor 1